PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC02G09400.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 263aa    MW: 27701.2 Da    PI: 6.4055
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC02G09400.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.32.5e-11136182551
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                      kr +r   NR +A+rsR RK+++i eLe+ v +L+ e +aL  ++  
  OPUNC02G09400.1 136 KRVKRILANRQSAQRSRVRKLQYISELERSVTTLQMEVSALSPRVAF 182
                      899**********************************9999877655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.1E-13132196IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.611134190IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.13E-11136190No hitNo description
Gene3DG3DSA:1.20.5.1707.9E-14136190No hitNo description
PfamPF001707.0E-10136186IPR004827Basic-leucine zipper domain
CDDcd147033.43E-22137187No hitNo description
PROSITE patternPS000360139154IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MAQLPPRAPS AAAGQEWSSV AAAGEFLGFA AARRGAHRRS ASDSAAFLVE AVPMDDVIVG  60
GGEFDRLDDE QLMSMFSDVE APAVSDGAGG ERGPGEAHLM DMGDGDDGMG ATSPAGAGAM  120
AAAAAAAAAD GIADPKRVKR ILANRQSAQR SRVRKLQYIS ELERSVTTLQ MEVSALSPRV  180
AFLDHQRSLL TVGNSHLKQR IAALAQDKIF KDAHQEALKK EIERLRQVYH QQQIKATGGA  240
DIATAASMQA KHELLACEGA AMR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002451860.11e-131hypothetical protein SORBIDRAFT_04g008840
SwissprotQ6K3R91e-132BZP19_ORYSJ; Basic leucine zipper 19
TrEMBLA0A0E0JXY80.0A0A0E0JXY8_ORYPU; Uncharacterized protein
STRINGSb04g008840.11e-130(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132238125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.11e-57bZIP family protein